r2games.com

đź–Ą Status: up
đź•’ Response Time: 0.750 sec
⬅️ Response Code: 200
r2games.com

From January 28, 2021, through the past 2 024 days, the availability of r2games.com has been checked 43 times. As of June 28, 2026, r2games.com responded with a 200 status code and was accessible 43 times out of the total checks that were made. Throughout all evaluations done as of August 14, 2026, r2games.com did not experience any offline periods. As of August 14, 2026, no recorded response had an error status out of all the replies that were received. R2games.com's 0.750 seconds reply on June 28, 2026, contrasted its 0.943 seconds average response time.

4.0
43
Last Updated: June 28, 2026

R2games overview

Domain
r2games.com
Title
Play Free Online Games, MMORPG, Browser Games - R2Games
Description
R2Games delivers the best of free-to-play web games. Join our thriving community of online gaming enthusiasts! No downloads or installations required – play anytime, anywhere!
Keywords
R2Games, R2, Free Online Games, Online Gaming, Play Free Games, MMORPG, ARPG, SLG, Adventure Games, Action Games, Strategy Games, Causal, Multi-Language, Browser Games, Video Games, Titan Revenge, Game of Thrones Winter is Coming, Dark Odyssey, League of Angelsâ… , League of Angelsâ…ˇ, League of Angelsâ…˘, Crystal Saga...
G Site Status Rank
2 137
Search Wikipedia
r2games.com
Alternatives
alternatives to r2games.com
Recently checked
verycd.com

morningstar.com

Last Updated: June 8, 2026
Status: up
Response Time: 1.500 sec
Response Code: 200

mengnalishaxb.tmall.com

Last Updated: June 29, 2026
Status: up
Response Time: 0.001 sec
Response Code: not set

gustos.ro

Last Updated: June 14, 2026
Status: up
Response Time: 0.107 sec
Response Code: 200

golyat.jp

Last Updated: July 6, 2026
Status: up
Response Time: 0.755 sec
Response Code: 200

gefen.com

Last Updated: April 25, 2026
Status: up
Response Time: 0.180 sec
Response Code: 200

sports-betting-community.com

Last Updated: May 23, 2026
Status: up
Response Time: 0.083 sec
Response Code: 200

rewardsgold.com

Last Updated: April 12, 2026
Status: up
Response Time: 0.467 sec
Response Code: 200

R2games.com
status check request map as of August 14, 2026

r2games.com request, June 28, 2026

Country report for r2games.com as of August 14, 2026

Other Countries 100.00%
22:06
SiteTotal ChecksLast Modified
desjardins.comdesjardins.com32January 29, 2021
verycd.comverycd.com44January 28, 2021
r2games.comr2games.com43January 28, 2021
fuskator.comfuskator.com155November 11, 2020
questionablecontent.netquestionablecontent.net51January 28, 2021

Sports-betting-community.com

R2games.com

General SEO Report

Page TitlePage Title tips for r2games.com: The title tag of targetwebsite.com is fundamental for local SEO as well; include location-based keywords along with your primary business or service keywords near the start to target geographically specific searches and improve visibility for local customers seeking your offerings.
Play Free Online Games, MMORPG, Browser Games - R2Games

Length: 55 characters
Meta DescriptionMeta Description tips for r2games.com: Keyword research heavily informs effective meta description writing; identify semantic variations, user questions, and related topics that your meta description can subtly address within the character constraints to capture more traffic.
R2Games delivers the best of free-to-play web games. Join our thriving community of online gaming enthusiasts! No downloads or installations required – play anytime, anywhere!

Length: 181 characters
Meta KeywordsMeta Keywords tips for r2games.com: Modern content optimization, including thorough keyword research and natural language usage, offers far more impactful results than any meta keywords tag configuration.
R2Games, R2, Free Online Games, Online Gaming, Play Free Games, MMORPG, ARPG, SLG, Adventure Games, Action Games, Strategy Games, Causal, Multi-Language, Browser Games, Video Games, Titan Revenge, Game of Thrones Winter is Coming, Dark Odyssey, League of Angelsâ… , League of Angelsâ…ˇ, League of Angelsâ…˘, Crystal Saga...

Count: 47 words
Page ContentPage Content tips for r2games.com: Focus on user engagement within your page content by crafting compelling introductions that hook readers, anticipating their questions, and providing valuable, trustworthy information that encourages exploration deeper into your content.
Web Page Content Length: 20814 characters
H1 HeadingH1 Heading tips for r2games.com: For local SEO, incorporating location-based keywords into your H1 header can significantly improve visibility for geographically targeted searches, making it a valuable practice for businesses with physical locations.
no h1 heading data for r2games.com
2026-08-14T13:18:37+00:00
H2 HeadingsH2 Headings tips for r2games.com: Employing well-chosen H2 headers significantly boosts website accessibility by providing clear navigation cues for screen readers, helping visually impaired users understand page structure more easily.
no h2 headings data for r2games.com
2026-08-14T13:18:37+00:00
H3 HeadingsH3 Headings tips for r2games.com: Using descriptive H3 headings improves both user experience and crawlability for search engines, helping to map page structure for better indexing and higher organic visibility within SERPs.
Games
Desktop
Premium
HOT & NEW GAMES
FEATURED GAMES
Transferred-Platform Games


Count: 6 heading tag
H4 HeadingsH4 Headings tips for r2games.com: While search engines understand heading hierarchy, consistently using H4 tags appropriately for sub-points under H3s is a best practice that contributes positively to your page's semantic relevance within specific topic areas.
no h4 headings data for r2games.com
2026-08-14T13:18:37+00:00
H5-H6 HeadingsH5-H6 Headings tips for r2games.com: Content strategists advise using H5-H6 headers primarily for internal linking within extensive articles, facilitating smoother navigation for website visitors.
no h5-h6 headings data for r2games.com
2026-08-14T13:18:37+00:00
Image ALT AttributesImage ALT Attributes tips for r2games.com: Use descriptive language that goes beyond basic identification of the image subject, explaining the context, action, or specific information being conveyed by the visual element, enriching accessibility and SEO value significantly.
https://r2cdn2.r2games.com/uploads/games/msapk_game_h.png
https://r2cdn2.r2games.com/uploads/games/loa_kong_game_h.png
https://r2cdn2.r2games.com/uploads/games/loa_armor_game_h.png


Count: 3 images with ALT attributes
Robots.txtRobots.txt tips for r2games.com: For sites with extensive archives or dynamic URL structures (e.g., paginated content), consider adding directives to robots.txt that help search engines prioritize the crawling of canonical, main-page URLs over infinite less important variants.
file robots.txt was found on the website
XML SitemapXML Sitemap tips for r2games.com: XML sitemaps are particularly beneficial for dynamic websites where content changes frequently or for sites with complex architectures, ensuring no page is left behind during the crawling and indexing cycle.
no xml sitemap data for r2games.com
2026-08-14T13:18:37+00:00
Page SizePage Size tips for r2games.com: Bounce rates often correlate strongly with website loading speed, which is heavily dependent on page size; reducing page weight significantly can lower exit rates and improve conversion opportunities on both desktop and mobile platforms.
page size: 20 kb
Response TimeResponse Time tips for r2games.com: Avoid unnecessary redirects, especially chains of redirects, as each hop adds delay to the request/response cycle, ultimately increasing Time To First Byte (TTFB) and negatively impacting page load speed performance metrics.
response time: 0.943 sec
Minify CSSMinify CSS tips for r2games.com: Consider CSS minification not just a performance tweak but a necessity for SEO success, as removing all formatting and comments significantly shrinks file size, leading to faster page speeds, better Core Web Vitals, improved user retention, and higher search engine rankings.
Unminified:
https://r2cdn2.r2games.com/en/www/css/pack/index.css?v=20240620
https://r2cdn2.r2games.com/en/www/css/pack/pre_reg.css
https://r2cdn2.r2games.com/en/www/css/common/media_jquery.css?v=20230828
https://r2cdn2.r2games.com/en/www/css/pack/search.css?v=20240621


included in the page
Minify JavaScriptMinify JavaScript tips for r2games.com: Search engine crawlers analyze site speed, so consistently implementing JS minification techniques ensures faster DOM manipulation and quicker content rendering, directly contributing to higher search rankings.
Minified:
https://r2cdn2.r2games.com/en/js/language/en.js
https://r2cdn2.r2games.com/en/js/search.js?v=20240906
https://r2cdn2.r2games.com/en/js/home.js?v=20220715
Unminified:
https://r2cdn2.r2games.com/en/js/lib/optiscroll.js?v=20240620
https://r2cdn2.r2games.com/en/js/lib/jquery.js


detected during site scan
Structured DataStructured Data tips for r2games.com: Rich results generated by Schema Markup can significantly elevate CTRs and dwell time by presenting your content with enhanced visual appeal and relevant details directly in search engine result pages, improving overall SEO effectiveness.
no structured data data for r2games.com
2026-08-14T13:18:37+00:00
CDN UsageCDN Usage tips for r2games.com: Optimize your website's delivery by selecting a high-quality CDN provider that offers intelligent caching mechanisms, effectively minimizing latency by serving cached content from the nearest edge server based on the user's geographic location.
content is delivered via CDN
SSL certificatesSSL certificates tips for r2games.com: SSL implementation is a foundational step recommended by search engines for improving website security and ranking potential; regularly check your site's SSL certificate validity period to prevent unexpected service interruptions.
SSL is enabled on the website

Estimated Traffic

Minimum Daily Unique Visitors:178 286
Minimum Daily Visits:208 358
Minimum Daily Page Views:358 719
Minimum Monthly Unique Visitors:5 348 580
Minimum Monthly Visits:6 250 740
Minimum Monthly Page Views:10 761 570
Minimum Yearly Unique Visitors:64 182 960
Minimum Yearly Visits:75 008 880
Minimum Yearly Page Views:129 138 840
Maximum Daily Unique Visitors:225 542
Maximum Daily Visits:240 578
Maximum Daily Page Views:405 976
Maximum Monthly Unique Visitors:6 766 260
Maximum Monthly Visits:7 217 340
Maximum Monthly Page Views:12 179 280
Maximum Yearly Unique Visitors:81 195 120
Maximum Yearly Visits:86 608 080
Maximum Yearly Page Views:146 151 360

Estimated Valuation

Daily Revenue:US$ 258 - 580
Monthly Revenue:US$ 7 740 - 17 400
Yearly Revenue:US$ 92 880 - 208 800

Estimated Worth

Minimum:US$ 139 320
Maximum:US$ 626 400

Similarly Ranked Sites

RankPoints
aircanada.comaircanada.com5 3995 544 363
plaync.complaync.com5 4005 544 362
nchsoftware.comnchsoftware.com5 4015 544 362
desjardins.comdesjardins.com5 4025 544 362
verycd.comverycd.com5 4035 544 361
r2games.comr2games.com5 4045 544 361
fuskator.comfuskator.com5 4055 544 360
questionablecontent.netquestionablecontent.net5 4065 544 360
thumbtack.comthumbtack.com5 4075 544 360
watchmygirlfriend.tvwatchmygirlfriend.tv5 4085 544 359
lever.colever.co5 4095 544 359